AGER Antibody - C-terminal region (ARP41642_P050)

Data Sheet
 
Product Number ARP41642_P050
Product Page www.avivasysbio.com/ager-antibody-c-terminal-region-arp41642-p050.html
Name AGER Antibody - C-terminal region (ARP41642_P050)
Protein Size (# AA) 342 amino acids
Molecular Weight 38kDa
NCBI Gene Id 177
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Advanced glycosylation end product-specific receptor
Alias Symbols RAGE, sRAGE, SCARJ1
Peptide Sequence Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Takahashi,K., (2006) Thromb. Haemost. 95 (2), 320-328
Description of Target AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AGER (ARP41642_P050) antibody
Specificity Isoform 2 specific
Blocking Peptide For anti-AGER (ARP41642_P050) antibody is Catalog # AAP41642 (Previous Catalog # AAPS09910)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human AGER
Uniprot ID A2BFI7
Protein Name Advanced glycosylation end product-specific receptor
Protein Accession # NP_751947
Purification Affinity Purified
Nucleotide Accession # NM_172197
Tested Species Reactivity Human
Gene Symbol AGER
Predicted Species Reactivity Human
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Lung
Rabbit Anti-AGER Antibody
Catalog Number: ARP41642
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 2
Human HepG2
WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com