Product Number |
ARP41642_P050 |
Product Page |
www.avivasysbio.com/ager-antibody-c-terminal-region-arp41642-p050.html |
Name |
AGER Antibody - C-terminal region (ARP41642_P050) |
Protein Size (# AA) |
342 amino acids |
Molecular Weight |
38kDa |
NCBI Gene Id |
177 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Advanced glycosylation end product-specific receptor |
Alias Symbols |
RAGE, sRAGE, SCARJ1 |
Peptide Sequence |
Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Takahashi,K., (2006) Thromb. Haemost. 95 (2), 320-328 |
Description of Target |
AGER mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. It is receptor for amyloid beta peptide.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms.This gene encodes a member of the immunoglobulin superfamily of cell surface molecules. It is a receptor for various molecules, including the amyloidogenic form of serum amyloid A, amyloid-beta protein, members of the S100/calgranulin superfamily and advanced glycation end products. The gene lies within the major histocompatibility complex (MHC) class III region on chromosome 6. Alternative splicing results in two transcript variants encoding different isoforms. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AGER (ARP41642_P050) antibody |
Specificity |
Isoform 2 specific |
Blocking Peptide |
For anti-AGER (ARP41642_P050) antibody is Catalog # AAP41642 (Previous Catalog # AAPS09910) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human AGER |
Uniprot ID |
A2BFI7 |
Protein Name |
Advanced glycosylation end product-specific receptor |
Protein Accession # |
NP_751947 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_172197 |
Tested Species Reactivity |
Human |
Gene Symbol |
AGER |
Predicted Species Reactivity |
Human |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Lung
| Rabbit Anti-AGER Antibody Catalog Number: ARP41642 Paraffin Embedded Tissue: Human Lung Cellular Data: Alveolar cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
| Image 2 | Human HepG2
| WB Suggested Anti-AGER Antibody Titration: 0.2-1 ug/ml Positive Control: HepG2 cell lysate |
|
|