SLC22A1 Antibody - C-terminal region (ARP41640_T100)

• Product Number: ARP41640_T100
• Name: SLC22A1 Antibody - C-terminal region (ARP41640_T100)
• Protein Size (# AA): 506 amino acids
• Molecular Weight: 56kDa
• NCBI Gene Id: 6580
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Solute carrier family 22 (organic cation transporter), member 1
• Alias Symbols: OCT1, HOCT1, oct1_cds
• Peptide Sequence: Synthetic peptide located within the following region: IAIQMICLVNAELYPTFVSGVGPACRGSDATSSRDQGGRFARDHEGRREP
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bourdet,D.L., (2005) J. Pharmacol. Exp. Ther. 315 (3), 1288-1297
• Description of Target: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein. Two transcript variants encoding two different isoforms have been found for this gene, but only the longer variant encodes a functional transporter.
• Protein Interactions: CERS2; POU2AF1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SLC22A1 (ARP41640_T100) antibody is Catalog # AAP41640 (Previous Catalog # AAPS09908)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SLC22A1
• Uniprot ID: O15245
• Protein Name: Solute carrier family 22 member 1
• Publications:

  Salomon, J. J. et al. The Cell Line NCl-H441 Is a Useful in Vitro Model for Transport Studies of Human Distal Lung Epithelial Barrier. Mol. Pharm. (2014). doi:10.1021/mp4006536 24524365

• Protein Accession #: NP_694857
• Purification: Protein A purified
• Nucleotide Accession #: NM_153187
• Tested Species Reactivity: Human
• Gene Symbol: SLC22A1
• Predicted Species Reactivity: Human
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Image 1: Human HepG2
  
  WB Suggested Anti-SLC22A1 Antibody Titration: 5.0ug/ml
  Positive Control: HepG2 cell lysate
• Image 2: Human Intestine
  
  Rabbit Anti-SLC22A1 Antibody
  Catalog Number: ARP41640
  Paraffin Embedded Tissue: Human Intestine
  Cellular Data: Epithelial cells of intestinal villas
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X