| Product Number |
ARP41526_P050 |
| Product Page |
www.avivasysbio.com/xpnpep2-antibody-c-terminal-region-arp41526-p050.html |
| Name |
Xpnpep2 Antibody - C-terminal region (ARP41526_P050) |
| Protein Size (# AA) |
674 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
170745 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound |
| Alias Symbols |
m, mAPP, 9030008G12Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: LIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Xpnpep2 (ARP41526_P050) antibody |
| Blocking Peptide |
For anti-Xpnpep2 (ARP41526_P050) antibody is Catalog # AAP41526 (Previous Catalog # AAPP24212) |
| Uniprot ID |
B1AVD1 |
| Protein Name |
Protein Xpnpep2 Ensembl ENSMUSP00000076951 |
| Protein Accession # |
NP_573476 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_133213 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Xpnpep2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 86%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 86%; Rat: 100% |
| Image 1 | Mouse Spleen
 | WB Suggested Anti-Xpnpep2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Spleen |
|
|
