Product Number |
ARP41458_P050 |
Product Page |
www.avivasysbio.com/ugt1a6-antibody-c-terminal-region-arp41458-p050.html |
Name |
UGT1A6 Antibody - C-terminal region (ARP41458_P050) |
Protein Size (# AA) |
532 amino acids |
Molecular Weight |
58kDa |
NCBI Gene Id |
54578 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
UDP glucuronosyltransferase 1 family, polypeptide A6 |
Alias Symbols |
GNT1, UGT1, HLUGP, UDPGT, UGT1A, UGT1C, UGT1E, UGT1F, HLUGP1, UGT-1A, UGT-1C, UGT-1E, UGT-1F, UGT1.1, UGT1.3, UGT1.5, UGT1.6, UGT1A1, UGT1A3, UGT1A5, UGT1-01, UGT1-03, UGT1-05, UGT1-06, UGT1A6S, hUG-BR1, UDPGT 1-6 |
Peptide Sequence |
Synthetic peptide located within the following region: APHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGK |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Berkhout,M., (2008) Br J Surg 95 (4), 499-505 |
Description of Target |
UGT1A6 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-UGT1A6 (ARP41458_P050) antibody |
Blocking Peptide |
For anti-UGT1A6 (ARP41458_P050) antibody is Catalog # AAP41458 (Previous Catalog # AAPS09204) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human UGT1A6 |
Uniprot ID |
P19224 |
Protein Name |
UDP-glucuronosyltransferase 1-6 |
Protein Accession # |
NP_001063 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001072 |
Tested Species Reactivity |
Human |
Gene Symbol |
UGT1A6 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
Application |
WB, IHC |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 92% |
Image 1 | Human 293T
| WB Suggested Anti-UGT1A6 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: 293T cell lysate |
| Image 2 | Human Liver Tissue
| UGT1A6 antibody - C-terminal region (ARP41458_P050)
Catalog Number: ARP41458_P050
Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue
Observed Staining: Cytoplasm in hepatocytes
Primary Antibody Concentration: 1:100
Other Working Concentrations: 1/600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
|
|