| Product Number |
ARP41438_T100 |
| Product Page |
www.avivasysbio.com/slc13a3-antibody-n-terminal-region-arp41438-t100.html |
| Name |
SLC13A3 Antibody - N-terminal region (ARP41438_T100) |
| Protein Size (# AA) |
602 amino acids |
| Molecular Weight |
66kDa |
| NCBI Gene Id |
64849 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 3 |
| Description |
|
| Alias Symbols |
NADC3, SDCT2, ARLIAK |
| Peptide Sequence |
Synthetic peptide located within the following region: MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Bai,X., (2006) J. Cell. Physiol. 206 (3), 821-830 |
| Description of Target |
Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. SLC13A3 represents the high-affinity form.Mammalian sodium-dicarboxylate cotransporters transport succinate and other Krebs cycle intermediates. They fall into 2 categories based on their substrate affinity: low affinity and high affinity. Both the low- and high-affinity transporters play an important role in the handling of citrate by the kidneys. The protein encoded by this gene represents the high-affinity form. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, although the full-length nature of some of them have not been characterized yet. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SLC13A3 (ARP41438_T100) antibody |
| Blocking Peptide |
For anti-SLC13A3 (ARP41438_T100) antibody is Catalog # AAP41438 (Previous Catalog # AAPS09203) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SLC13A3 |
| Uniprot ID |
Q8WWT9 |
| Protein Name |
Solute carrier family 13 member 3 |
| Publications |
Macrophage-Derived Extracellular Succinate Licenses Neural Stem Cells to Suppress Chronic Neuroinflammation. Cell Stem Cell. 22, 355-368.e13 (2018). 29478844 |
| Sample Type Confirmation |
SLC13A3 is strongly supported by BioGPS gene expression data to be expressed in HepG2 |
| Protein Accession # |
NP_073740 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_022829 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SLC13A3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
| Image 1 | Human HepG2
 | WB Suggested Anti-SLC13A3 Antibody Titration: 5.0ug/ml
Positive Control: HepG2 cell lysateSLC13A3 is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells |
|
