| Product Number |
ARP41298_P050 |
| Product Page |
www.avivasysbio.com/brwd1-antibody-n-terminal-region-arp41298-p050.html |
| Name |
BRWD1 Antibody - N-terminal region (ARP41298_P050) |
| Protein Size (# AA) |
120 amino acids |
| Molecular Weight |
13kDa |
| NCBI Gene Id |
54014 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Bromodomain and WD repeat domain containing 1 |
| Alias Symbols |
N143, WDR9, WRD9, DCAF19, C21orf107 |
| Peptide Sequence |
Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Hu,Y.H., (er) BMC Genomics 7, 155 (2006) |
| Description of Target |
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com |
| Protein Interactions |
CUL3; APP; COPS5; CUL4A; SUMO2; UBC; CALM1; UBXN7; SMARCA4; DDB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-BRWD1 (ARP41298_P050) antibody |
| Blocking Peptide |
For anti-BRWD1 (ARP41298_P050) antibody is Catalog # AAP41298 (Previous Catalog # AAPP22653) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human BRWD1 |
| Uniprot ID |
Q6P2D1 |
| Protein Name |
Bromodomain and WD repeat-containing protein 1 |
| Protein Accession # |
NP_001007247 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001007246 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
BRWD1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93% |
| Image 1 | Human PANC1
 | WB Suggested Anti-BRWD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate |
|
