BRWD1 antibody - N-terminal region (ARP41298_P050)
Data Sheet
Product Number ARP41298_P050
Product Page
Product Name BRWD1 antibody - N-terminal region (ARP41298_P050)
Size 100 ul
Gene Symbol BRWD1
Alias Symbols C21orf107, FLJ43918, N143, WDR9
Protein Size (# AA) 120 amino acids
Molecular Weight 13kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 54014
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Bromodomain and WD repeat domain containing 1
Description This is a rabbit polyclonal antibody against BRWD1. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK
Target Reference Hu,Y.H., (er) BMC Genomics 7, 155 (2006)
Description of Target This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
Protein Interactions CUL3; APP; COPS5; CUL4A; SUMO2; UBC; CALM1; UBXN7; SMARCA4; DDB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-BRWD1 (ARP41298_P050) antibody is Catalog # AAP41298 (Previous Catalog # AAPP22653)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human BRWD1
Complete computational species homology data Anti-BRWD1 (ARP41298_P050)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express BRWD1.
Swissprot Id Q6P2D1
Protein Name Bromodomain and WD repeat-containing protein 1
Protein Accession # NP_001007247
Purification Affinity Purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express BRWD1.
Nucleotide Accession # NM_001007246
Replacement Item This antibody may replace item sc-141758 from Santa Cruz Biotechnology.
Conjugation Options

ARP41298_P050-FITC Conjugated

ARP41298_P050-HRP Conjugated

ARP41298_P050-Biotin Conjugated

CB Replacement sc-141758; sc-83517; sc-91399
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rat: 93%
Image 1
Human PANC1
WB Suggested Anti-BRWD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |