PCBP3 Antibody - middle region (ARP40947_P050)

Data Sheet
 
Product Number ARP40947_P050
Product Page www.avivasysbio.com/pcbp3-antibody-middle-region-arp40947-p050.html
Name PCBP3 Antibody - middle region (ARP40947_P050)
Protein Size (# AA) 339 amino acids
Molecular Weight 36kDa
NCBI Gene Id 54039
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Poly(rC) binding protein 3
Alias Symbols PCBP3OT, ALPHA-CP3, PCBP3-OT1
Peptide Sequence Synthetic peptide located within the following region: QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lim,J., (2006) Cell 125 (4), 801-814
Description of Target This gene encodes a member of the KH-domain protein subfamily. Proteins of this subfamily, also referred to as alpha-CPs, bind to RNA with a specificity for C-rich pyrimidine regions. Alpha-CPs play important roles in post-transcriptional activities and h
Protein Interactions FAM96B; UBC; PFKL; SPEN; PTBP2; PTBP1; Aif1l; RBM39; RUVBL2; RUVBL1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PCBP3 (ARP40947_P050) antibody
Blocking Peptide For anti-PCBP3 (ARP40947_P050) antibody is Catalog # AAP40947 (Previous Catalog # AAPS02611)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PCBP3
Uniprot ID P57721
Protein Name Poly(rC)-binding protein 3
Protein Accession # NP_065389
Purification Affinity Purified
Nucleotide Accession # NM_020528
Tested Species Reactivity Human
Gene Symbol PCBP3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human HT1080
WB Suggested Anti-PCBP3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HT1080 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com