NXF3 Antibody - C-terminal region (ARP40875_T100)

• Product Number: ARP40875_T100
• Name: NXF3 Antibody - C-terminal region (ARP40875_T100)
• Protein Size (# AA): 531 amino acids
• Molecular Weight: 58kDa
• NCBI Gene Id: 56000
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Nuclear RNA export factor 3
• Peptide Sequence: Synthetic peptide located within the following region: SSFLVDMWYQTEWMLCFSVNGVFKEVEGQSQGSVLAFTRTFIATPGSSSS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Jun,L., (2001) Curr. Biol. 11 (18), 1381-1391
• Description of Target: NXF3 is one member of a family of nuclear RNA export factors. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF3 has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene has shortened LRR and ubiquitin-associated domains and its RDB is unable to bind RNA. It is located in the nucleoplasm but is not associated with either the nuclear envelope or the nucleolus.
• Protein Interactions: NXT2; NXT1; SKIL; NXF1; HHV8GK18_gp81; HNRNPUL1; XPO1; NUP214;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-NXF3 (ARP40875_T100) antibody is Catalog # AAP40875 (Previous Catalog # AAPP22853)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NXF3
• Uniprot ID: Q9H4D5
• Protein Name: Nuclear RNA export factor 3
• Sample Type Confirmation:

  NXF3 is supported by BioGPS gene expression data to be expressed in RPMI 8226

• Protein Accession #: NP_071335
• Purification: Protein A purified
• Nucleotide Accession #: NM_022052
• Tested Species Reactivity: Human
• Gene Symbol: NXF3
• Predicted Species Reactivity: Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: IHC, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 77%; Horse: 79%; Human: 100%; Pig: 92%; Rabbit: 92%; Rat: 77%
• Image 1: Human Heart
  
  Rabbit Anti-NXF3 Antibody
  Catalog Number: ARP40875
  Paraffin Embedded Tissue: Human Heart
  Cellular Data: Myocardial cells
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 2: Human Kidney
  
  Rabbit Anti-NXF3 Antibody
  Catalog Number: ARP40875
  Paraffin Embedded Tissue: Human Kidney
  Cellular Data: Epithelial cells of renal tubule
  Antibody Concentration: 4.0-8.0 ug/ml
  Magnification: 400X
• Image 3: Human RPMI 8226
  
  WB Suggested Anti-NXF3 Antibody Titration: 1.25ug/ml
  Positive Control: RPMI 8226 cell lysateNXF3 is supported by BioGPS gene expression data to be expressed in RPMI 8226