PRPF6 Antibody - C-terminal region (ARP40734_T100)

Data Sheet
 
Product Number ARP40734_T100
Product Page www.avivasysbio.com/prpf6-antibody-c-terminal-region-arp40734-t100.html
Name PRPF6 Antibody - C-terminal region (ARP40734_T100)
Protein Size (# AA) 941 amino acids
Molecular Weight 104kDa
NCBI Gene Id 24148
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PRP6 pre-mRNA processing factor 6 homolog (S. cerevisiae)
Alias Symbols TOM, ANT1, Prp6, RP60, ANT-1, hPrp6, U5-102K, C20orf14, SNRNP102
Peptide Sequence Synthetic peptide located within the following region: FWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Fan,S., (2006) Biochem. Biophys. Res. Commun. 341 (1), 192-201
Description of Target PRPF6 appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. PRPF6 also can bind androgen receptor, providing a link between transcriptional activation and splicing.The protein encoded by this gene appears to be involved in pre-mRNA splicing, possibly acting as a bridging factor between U5 and U4/U6 snRNPs in formation of the spliceosome. The encoded protein also can bind androgen receptor, providing a link between transcriptional activation and splicing.
Protein Interactions SUMO2; SUMO3; UBC; MDM2; PASK; RPA3; RPA2; RPA1; EED; rev; PARK2; PRPF4B; UBD; HDAC11; CTNNB1; MMS19; MYC; IK; PRPF31; SRRM2; CD2BP2; WHSC1; NOTCH1; ZNF326; TRA2A; PRPF19; SF3B3; NCSTN; SNRNP200; ACIN1; U2AF2; SUPT16H; PRPF8; RBM14; SAP18; THRAP3; EIF4A3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRPF6 (ARP40734_T100) antibody
Blocking Peptide For anti-PRPF6 (ARP40734_T100) antibody is Catalog # AAP40734 (Previous Catalog # AAPY00986)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PRPF6
Uniprot ID O94906
Protein Name Pre-mRNA-processing factor 6
Protein Accession # NP_036601
Purification Protein A purified
Nucleotide Accession # NM_012469
Tested Species Reactivity Human
Gene Symbol PRPF6
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 86%
Image 1
Transfected 293T
WB Suggested Anti-PRPF6 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com