| Product Number |
ARP40717_T100 |
| Product Page |
www.avivasysbio.com/adat1-antibody-c-terminal-region-arp40717-t100.html |
| Name |
ADAT1 Antibody - C-terminal region (ARP40717_T100) |
| Protein Size (# AA) |
353 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
23536 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Adenosine deaminase, tRNA-specific 1 |
| Alias Symbols |
HADAT1 |
| Peptide Sequence |
Synthetic peptide located within the following region: RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Venter,J.C., Science 291 (5507), 1304-1351 (2001) |
| Description of Target |
ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA. |
| Protein Interactions |
UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ADAT1 (ARP40717_T100) antibody |
| Blocking Peptide |
For anti-ADAT1 (ARP40717_T100) antibody is Catalog # AAP40717 (Previous Catalog # AAPY00969) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ADAT1 |
| Uniprot ID |
Q9NVB7 |
| Protein Name |
tRNA-specific adenosine deaminase 1 |
| Protein Accession # |
EAW95626 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_012091 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ADAT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human Heart
 | Rabbit Anti-ADAT1 Antibody
Catalog Number: ARP40717
Paraffin Embedded Tissue: Human Heart
Cellular Data: Myocardial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
| Image 2 | Human Jurkat
 | WB Suggested Anti-ADAT1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate |
|
