| Product Number |
ARP40699_T100 |
| Product Page |
www.avivasysbio.com/u1snrnpbp-antibody-n-terminal-region-arp40699-t100.html |
| Name |
U1SNRNPBP Antibody - N-terminal region (ARP40699_T100) |
| Protein Size (# AA) |
251 amino acids |
| Molecular Weight |
28kDa |
| NCBI Gene Id |
11066 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Small nuclear ribonucleoprotein 35kDa (U11/U12) |
| Alias Symbols |
HM-1, U1SNRNPBP |
| Peptide Sequence |
Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Will,C.L., (2004) RNA 10 (6), 929-941 |
| Description of Target |
U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.The protein encoded by this gene is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors. This gene is differentially expressed in a variety of human tissues. Multiple alternatively spliced transcript variants have been found for this gene, and they differ in the 5' sequence regions. |
| Protein Interactions |
SRPK2; APP; TAB1; TNFSF11; MAP4K2; ILK; RNU11; RNU12-2P; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SNRNP35 (ARP40699_T100) antibody |
| Blocking Peptide |
For anti-SNRNP35 (ARP40699_T100) antibody is Catalog # AAP40699 (Previous Catalog # AAPY00951) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human U1SNRNPBP |
| Uniprot ID |
Q5XKN9 |
| Protein Name |
U11/U12 small nuclear ribonucleoprotein 35 kDa protein |
| Protein Accession # |
NP_851034 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_180703 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SNRNP35 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-U1SNRNPBP Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Kidney
 | Rabbit Anti-U1SNRNPBP Antibody
Catalog Number: ARP40699
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
