APOBEC2 Antibody - N-terminal region (ARP40683_T100)

Data Sheet
 
Product Number ARP40683_T100
Product Page www.avivasysbio.com/apobec2-antibody-n-terminal-region-arp40683-t100.html
Name APOBEC2 Antibody - N-terminal region (ARP40683_T100)
Protein Size (# AA) 224 amino acids
Molecular Weight 25kDa
NCBI Gene Id 10930
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
Alias Symbols ARP1, ARCD1
Peptide Sequence Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Wedekind,J.E., (2003) Trends Genet. 19 (4), 207-216
Description of Target APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity.
Protein Interactions APOBEC1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APOBEC2 (ARP40683_T100) antibody
Blocking Peptide For anti-APOBEC2 (ARP40683_T100) antibody is Catalog # AAP40683 (Previous Catalog # AAPY00935)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC2
Uniprot ID Q9Y235
Protein Name Probable C->U-editing enzyme APOBEC-2
Protein Accession # NP_006780
Purification Protein A purified
Nucleotide Accession # NM_006789
Tested Species Reactivity Human
Gene Symbol APOBEC2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 90%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 90%
Image 1
Human Muscle
WB Suggested Anti-APOBEC2 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
Image 2
Human Skin
Rabbit Anti-APOBEC2 Antibody
Catalog Number: ARP40683
Paraffin Embedded Tissue: Human Skin
Cellular Data: Squamous epithelial cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com