Product Number |
ARP40683_T100 |
Product Page |
www.avivasysbio.com/apobec2-antibody-n-terminal-region-arp40683-t100.html |
Name |
APOBEC2 Antibody - N-terminal region (ARP40683_T100) |
Protein Size (# AA) |
224 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
10930 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 |
Alias Symbols |
ARP1, ARCD1 |
Peptide Sequence |
Synthetic peptide located within the following region: VATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Wedekind,J.E., (2003) Trends Genet. 19 (4), 207-216 |
Description of Target |
APOBEC2 belongs to the cytidine and deoxycytidylate deaminase family. It is probable C to U editing enzyme whose physiological substrate is not yet known. It does not display detectable apoB mRNA editing and has a low intrinsic cytidine deaminase activity. |
Protein Interactions |
APOBEC1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-APOBEC2 (ARP40683_T100) antibody |
Blocking Peptide |
For anti-APOBEC2 (ARP40683_T100) antibody is Catalog # AAP40683 (Previous Catalog # AAPY00935) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human APOBEC2 |
Uniprot ID |
Q9Y235 |
Protein Name |
Probable C->U-editing enzyme APOBEC-2 |
Protein Accession # |
NP_006780 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_006789 |
Tested Species Reactivity |
Human |
Gene Symbol |
APOBEC2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
IHC, WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 90%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 90% |
Image 1 | Human Muscle
| WB Suggested Anti-APOBEC2 Antibody Titration: 1.25ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle |
|
Image 2 | Human Skin
| Rabbit Anti-APOBEC2 Antibody Catalog Number: ARP40683 Paraffin Embedded Tissue: Human Skin Cellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X |
|