THOC1 Antibody - C-terminal region (ARP40578_P050)

Data Sheet
 
Product Number ARP40578_P050
Product Page www.avivasysbio.com/thoc1-antibody-c-terminal-region-arp40578-p050.html
Name THOC1 Antibody - C-terminal region (ARP40578_P050)
Protein Size (# AA) 657 amino acids
Molecular Weight 76kDa
Subunit 1
NCBI Gene Id 9984
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name THO complex 1
Alias Symbols P84, HPR1, P84N5
Peptide Sequence Synthetic peptide located within the following region: TNQQFKSLQEYLENMVIKLAKELPPPSEEIKTGEDEDEEDNDALLKENES
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Li,Y., (2005) Mol. Cell. Biol. 25 (10), 4023-4033
Description of Target HPR1 is part of the TREX (transcription/export) complex, which includes TEX1 (MIM 606929), THO2 (MIM 300395), ALY (MIM 604171), and UAP56 (MIM 142560).[supplied by OMIM, Nov 2010]
Protein Interactions USHBP1; MOAP1; TRIM54; RABGEF1; THOC2; SUMO2; UBC; SUMO1; RPA3; RPA2; RPA1; RNF2; FRA10AC1; WDR77; SAP30BP; SF3B2; THOC1; THOC5; IK; DHX8; UBR7; TRMT112; SF3B1; RRP9; USP13; DDX39B; UTRN; TPM3; TPM1; VPS53; ZNF830; THOC3; THOC7; THOC6; XPO4; ZC3H15; ZCCHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-THOC1 (ARP40578_P050) antibody
Blocking Peptide For anti-THOC1 (ARP40578_P050) antibody is Catalog # AAP40578 (Previous Catalog # AAPP22754)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human THOC1
Uniprot ID Q96FV9
Protein Name THO complex subunit 1
Protein Accession # NP_005122
Purification Affinity Purified
Nucleotide Accession # NM_005131
Tested Species Reactivity Human, Mouse
Gene Symbol THOC1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 77%
Image 1
Human HepG2
WB Suggested Anti-THOC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Mouse Small Intestine
Rabbit Anti-THOC1 Antibody
Catalog Number: arp40578
Paraffin Embedded Tissue: Murine Small Intestine
Cellular Data: Crypt-Villus Axis
Antibody Concentration: 0.1 ug/ml
Magnification: 40X
Image 3
Human Kidney
Rabbit Anti-THOC1 Antibody
Catalog Number: ARP40578
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 4
Human Lung
Rabbit Anti-THOC1 Antibody
Catalog Number: ARP40578
Paraffin Embedded Tissue: Human Lung
Cellular Data: Alveolar cells
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
Image 5
human prostate tumor
human prostate tumor Primary Antibodies (from Aviva, Thoc1, Cat No: ARP 40578-P050)(1:150 dilution)
Image 6
human prostate
human prostate Primary Antibodies (from Aviva, Thoc1, Cat No: ARP 40578-P050)(1:150 dilution)
Image 7
Human Lung
Rabbit Anti-THOC1 Antibody
Catalog Number: ARP40578
Paraffin Embedded Tissue: Human alveolar cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com