RBM39 Antibody - middle region (ARP40559_P050)

Data Sheet
 
Product Number ARP40559_P050
Product Page www.avivasysbio.com/rbm39-antibody-middle-region-arp40559-p050.html
Name RBM39 Antibody - middle region (ARP40559_P050)
Protein Size (# AA) 193 amino acids
Molecular Weight 20kDa
NCBI Gene Id 9584
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name RNA binding motif protein 39
Alias Symbols HCC1, CAPER, RNPC2, FSAP59, CAPERalpha
Peptide Sequence Synthetic peptide located within the following region: FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
Protein Interactions RP9P; KRTAP12-2; SREK1IP1; FAM200A; AK8; HOMEZ; PRPF40A; C11orf57; THAP1; BANP; ZCCHC10; ARL6IP4; KIAA0907; SAP18; SF3B4; PPIG; SRSF11; ZBTB22; UBC; TP53; MLX; SRPK2; SP100; SDCBP; REL; GOLGA2; PHC2; CLK2; SPRTN; SUMO2; SUMO3; MDM2; RPA3; RPA2; RPA1; WWOX
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-RBM39 (ARP40559_P050) antibody
Blocking Peptide For anti-RBM39 (ARP40559_P050) antibody is Catalog # AAP40559 (Previous Catalog # AAPP22737)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RBM39
Uniprot ID Q5QP22
Protein Name RNA binding motif protein 39 EMBL CAI13607.1
Protein Accession # CAI13607
Purification Affinity Purified
Nucleotide Accession # NM_001242599
Tested Species Reactivity Human
Gene Symbol RBM39
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 91%
Image 1
Transfected 293T
WB Suggested Anti-RBM39 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com