EIF3G Antibody - middle region (ARP40485_P050)

• Product Number: ARP40485_P050
• Name: EIF3G Antibody - middle region (ARP40485_P050)
• Protein Size (# AA): 320 amino acids
• Molecular Weight: 35kDa
• Subunit: G
• NCBI Gene Id: 8666
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Eukaryotic translation initiation factor 3, subunit G
• Alias Symbols: EIF3S4, EIF3-P42, eIF3-p44, eIF3-delta
• Peptide Sequence: Synthetic peptide located within the following region: LRDGASRRGESMQPNRRADDNATIRVTNLSEDTRETDLQELFRPFGSISR
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)
• Description of Target: EIF3G belongs to the eIF-3 subunit G family. It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis.
• Protein Interactions: FAM9B; GOLGA2; SUMO2; EIF3I; NCL; DYNC1I2; EIF3B; EIF3C; NPM1; ICAM1; CD81; IGSF8; PAN2; EIF3D; DDX3X; gag-pol; EIF3L; EIF3K; EIF3M; EIF3H; EIF3F; EIF3A; EIF3E; APP; CUL3; ACD; POT1; YWHAZ; UBC; GADD45G; TK1; SNCA; SMN1; PKN2; PIN1; Itsn2; USP3; MPHOSPH6;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Other Applications Image 1 Data: IP Suggested Anti-EIF3G Antibody
  Positive Control: NT2 CELL/BRAIN TISSUE
  
• Other Applications Image 2 Data: IP Suggested Anti-EIF3G antibody
  Titration: 2 ug/ml
  Positive Control: Mouse brain homogenate
  
• Blocking Peptide: For anti-EIF3G (ARP40485_P050) antibody is Catalog # AAP40485 (Previous Catalog # AAPS03112)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EIF3G
• Uniprot ID: O75821
• Protein Name: Eukaryotic translation initiation factor 3 subunit G
• Sample Type Confirmation:

  EIF3G is supported by BioGPS gene expression data to be expressed in HEK293T, MCF7

• Protein Accession #: NP_003746
• Purification: Affinity Purified
• Nucleotide Accession #: NM_003755
• Tested Species Reactivity: Human, Mouse
• Gene Symbol: EIF3G
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Zebrafish
• Application: IHC, IP, WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Goat: 86%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-EIF3G Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Jurkat cell lysate
• Image 2: Mouse brain
  
  Amount and Sample Type:
  500 ug mouse brain homogenate
  Amount of IP Antibody:
  6 ug
  Primary Antibody:
  EIF3G
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:5000
  Gene Name:
  EIF3G
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
• Image 3: Human brain stem
  
  Sample Type:
  Human brain stem cells
  Primary Antibody Dilution:
  1:500
  Secondary Antibody:
  Goat anti-rabbit Alexa-Fluor 594
  Secondary Antibody Dilution:
  1:1000
  Color/Signal Descriptions:
  EIF3G: Red DAPI:Blue
  Gene Name:
  EIF3G
  Submitted by:
  Dr. Yuzhi Chen, University of Arkansas for Medical Science
• Image 4: Human MCF7
  
  Host: Rabbit
  Target Name: EIF3G
  Sample Type: MCF7
  Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in MCF7
• Image 5: Human 293T
  
  Host: Rabbit
  Target Name: EIF3G
  Sample Type: 293T
  Antibody Dilution: 1.0ug/mlEIF3G is supported by BioGPS gene expression data to be expressed in HEK293T