| Product Number |
ARP40354_P050 |
| Product Page |
www.avivasysbio.com/cstf3-antibody-n-terminal-region-arp40354-p050.html |
| Name |
CSTF3 Antibody - N-terminal region (ARP40354_P050) |
| Protein Size (# AA) |
717 amino acids |
| Molecular Weight |
79kDa |
| Subunit |
3 |
| NCBI Gene Id |
1479 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
| Alias Symbols |
CSTF-77 |
| Peptide Sequence |
Synthetic peptide located within the following region: YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Benoit,B., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (16), 10593-10598 |
| Description of Target |
CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Protein Interactions |
RBBP6; UBC; WWOX; rev; HECW2; POLR2A; WHSC1; CSTF1; CSTF2T; GAPDH; CSTF2; CUL3; HNRNPA1; CPSF1; RRAGA; CDC73; VHL; E2F4; ASF1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-CSTF3 (ARP40354_P050) antibody |
| Blocking Peptide |
For anti-CSTF3 (ARP40354_P050) antibody is Catalog # AAP40354 (Previous Catalog # AAPP10391) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CSTF3 |
| Uniprot ID |
Q12996 |
| Protein Name |
Cleavage stimulation factor subunit 3 |
| Protein Accession # |
NP_001317 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001326 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
CSTF3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-CSTF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human Tonsil
 | Rabbit Anti-CSTF3 antibody
Catalog Number: ARP40354
Formalin Fixed Paraffin Embedded Tissue: Human Tonsil
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec
|
|
