| Product Number |
ARP40267_T100 |
| Product Page |
www.avivasysbio.com/kyat3-antibody-n-terminal-region-arp40267-t100.html |
| Name |
KYAT3 Antibody - N-terminal region (ARP40267_T100) |
| Protein Size (# AA) |
420 amino acids |
| Molecular Weight |
46kDa |
| NCBI Gene Id |
56267 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
kynurenine aminotransferase 3 |
| Alias Symbols |
KAT3, CCBL2, KATIII |
| Peptide Sequence |
Synthetic peptide located within the following region: SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Marques,A.C., PLoS Biol. 3 (11), E357 (2005) |
| Description of Target |
This gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid, which is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene. This gene shares 5' exon structure with the RNA binding motif protein, X-linked-like 1 locus on chromosome 1, but the coding sequences are non-overlapping. |
| Protein Interactions |
UBC; LIN28A; COPS5; CUL1; CUL4B; RABIF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-KYAT3 (ARP40267_T100) antibody |
| Blocking Peptide |
For anti-KYAT3 (ARP40267_T100) antibody is Catalog # AAP40267 (Previous Catalog # AAPP23470) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RP11-82K18.3 |
| Uniprot ID |
Q6YP21 |
| Protein Name |
kynurenine--oxoglutarate transaminase 3 |
| Sample Type Confirmation |
CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_001008662 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_001008662 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
KYAT3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 93%; Guinea Pig: 85%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 86%; Rat: 91%; Zebrafish: 91% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-RP11-82K18.3 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysateCCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat |
|
