APOBEC3F Antibody - middle region (ARP40254_P050)

Data Sheet
 
Product Number ARP40254_P050
Product Page www.avivasysbio.com/apobec3f-antibody-middle-region-arp40254-p050.html
Name APOBEC3F Antibody - middle region (ARP40254_P050)
Protein Size (# AA) 373 amino acids
Molecular Weight 45kDa
NCBI Gene Id 200316
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
Alias Symbols A3F, KA6, ARP8, BK150C2.4.MRNA
Peptide Sequence Synthetic peptide located within the following region: MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQ
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yang,L., (2008) J. Virol. 82 (11), 5636-5642
Description of Target This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Interactions vif; BMI1; ACD; TINF2; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-APOBEC3F (ARP40254_P050) antibody
Blocking Peptide For anti-APOBEC3F (ARP40254_P050) antibody is Catalog # AAP40254 (Previous Catalog # AAPS00603)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human APOBEC3F
Uniprot ID Q8IUX4
Protein Name DNA dC->dU-editing enzyme APOBEC-3F
Protein Accession # NP_660341
Purification Affinity Purified
Nucleotide Accession # NM_145298
Tested Species Reactivity Human
Gene Symbol APOBEC3F
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Brain
WB Suggested Anti-APOBEC3F Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com