PRMT1 Antibody - middle region (ARP40198_T100)

Data Sheet
 
Product Number ARP40198_T100
Product Page www.avivasysbio.com/prmt1-antibody-middle-region-arp40198-t100.html
Name PRMT1 Antibody - middle region (ARP40198_T100)
Protein Size (# AA) 361 amino acids
Molecular Weight 40kDa
NCBI Gene Id 3276
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Protein arginine methyltransferase 1
Alias Symbols ANM1, HCP1, IR1B4, HRMT1L2
Peptide Sequence Synthetic peptide located within the following region: ESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Adams,M.M., (2005) Cell Cycle 4 (12), 1854-1861
Description of Target PRMT1 is a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4.The HRMT1L2 gene encodes a protein arginine methyltransferase that functions as a histone methyltransferase specific for H4 (see MIM 602822).[supplied by OMIM].
Protein Interactions PRMT1; FUS; PRMT8; WDYHV1; SPEG; HNRNPR; HUWE1; SUMO2; UBC; DGCR8; Fbxl16; SUZ12; VHL; OFCC1; FAM9A; SAMD3; C20orf196; SPSB2; C4orf17; FAM83D; SPSB1; C17orf53; COPS7B; MLST8; GRHL3; GPATCH2L; DCAF16; DCAF8; SPAG8; ZNF451; WDFY3; VPS72; TBX6; PPARA; NCL; M
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRMT1 (ARP40198_T100) antibody
Blocking Peptide For anti-PRMT1 (ARP40198_T100) antibody is Catalog # AAP40198 (Previous Catalog # AAPS01609)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PRMT1
Uniprot ID Q99873
Protein Name Protein arginine N-methyltransferase 1
Protein Accession # NP_001527
Purification Protein A purified
Nucleotide Accession # NM_001536
Tested Species Reactivity Human
Gene Symbol PRMT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Jurkat
WB Suggested Anti-PRMT1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
Image 2
Human Kidney
Rabbit Anti-PRMT1 Antibody
Catalog Number: ARP40198
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com