Product Number |
ARP39969_P050 |
Product Page |
www.avivasysbio.com/znf398-antibody-c-terminal-region-arp39969-p050.html |
Name |
ZNF398 Antibody - C-terminal region (ARP39969_P050) |
Protein Size (# AA) |
642 amino acids |
Molecular Weight |
71kDa |
NCBI Gene Id |
57541 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 398 |
Alias Symbols |
P51, P71, ZER6 |
Peptide Sequence |
Synthetic peptide located within the following region: GCGGDSDPSGQPPNPPGPLITGLETSGLGVNTEGLETNQWYGEGSGGGVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Scherer,S.W., (2003) Science 300 (5620), 767-772 |
Description of Target |
ZNF398 is a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. This protein acts as a transcriptional activator.This gene encodes a member of the Kruppel family of C2H2-type zinc-finger transcription factor proteins. The encoded protein acts as a transcriptional activator. Two transcript variants encoding distinct isoforms have been identified for this gene. Other transcript variants have been described, but their full length sequence has not been determined. |
Protein Interactions |
LOC155060; CIB3; PLEKHF2; GPATCH2L; MAGOHB; C1orf109; OPTN; ELMO1; MFAP1; CLK2; NDE1; DGCR6; ESR1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF398 (ARP39969_P050) antibody |
Blocking Peptide |
For anti-ZNF398 (ARP39969_P050) antibody is Catalog # AAP39969 (Previous Catalog # AAPP10281) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF398 |
Uniprot ID |
Q8TD17 |
Protein Name |
Zinc finger protein 398 |
Protein Accession # |
NP_733787 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_170686 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF398 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 79% |
Image 1 | Human HepG2
| WB Suggested Anti-ZNF398 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
|
|