HMGB4 Antibody - C-terminal region (ARP39852_P050)

Data Sheet
 
Product Number ARP39852_P050
Product Page www.avivasysbio.com/hmgb4-antibody-c-terminal-region-arp39852-p050.html
Name HMGB4 Antibody - C-terminal region (ARP39852_P050)
Protein Size (# AA) 186 amino acids
Molecular Weight 22kDa
NCBI Gene Id 127540
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name High mobility group box 4
Alias Symbols dJ1007G16.5
Peptide Sequence Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45
Description of Target HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription.
Protein Interactions KRTAP12-4; CEP70; APP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HMGB4 (ARP39852_P050) antibody
Blocking Peptide For anti-HMGB4 (ARP39852_P050) antibody is Catalog # AAP39852 (Previous Catalog # AAPP10054)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB4
Uniprot ID Q8WW32
Protein Name High mobility group protein B4
Protein Accession # NP_660206
Purification Affinity Purified
Nucleotide Accession # NM_145205
Tested Species Reactivity Human
Gene Symbol HMGB4
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com