Product Number |
ARP39852_P050 |
Product Page |
www.avivasysbio.com/hmgb4-antibody-c-terminal-region-arp39852-p050.html |
Name |
HMGB4 Antibody - C-terminal region (ARP39852_P050) |
Protein Size (# AA) |
186 amino acids |
Molecular Weight |
22kDa |
NCBI Gene Id |
127540 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
High mobility group box 4 |
Alias Symbols |
dJ1007G16.5 |
Peptide Sequence |
Synthetic peptide located within the following region: WSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMSARNRCRG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., et al., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
HMGB4 contains two HMG-box regions, which is found in a variety of eukaryotic chromosomal proteins and transcription. |
Protein Interactions |
KRTAP12-4; CEP70; APP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HMGB4 (ARP39852_P050) antibody |
Blocking Peptide |
For anti-HMGB4 (ARP39852_P050) antibody is Catalog # AAP39852 (Previous Catalog # AAPP10054) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HMGB4 |
Uniprot ID |
Q8WW32 |
Protein Name |
High mobility group protein B4 |
Protein Accession # |
NP_660206 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_145205 |
Tested Species Reactivity |
Human |
Gene Symbol |
HMGB4 |
Predicted Species Reactivity |
Human |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-HMGB4 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate |
|
|