| Product Number |
ARP39817_T100 |
| Product Page |
www.avivasysbio.com/foxp4-antibody-c-terminal-region-arp39817-t100.html |
| Name |
FOXP4 Antibody - C-terminal region (ARP39817_T100) |
| Protein Size (# AA) |
667 amino acids |
| Molecular Weight |
72kDa |
| NCBI Gene Id |
116113 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Forkhead box P4 |
| Alias Symbols |
hFKHLA |
| Peptide Sequence |
Synthetic peptide located within the following region: PRLSPPQYSHQVQVKEEPAEAEEDRQPGPPLGAPNPSASGPPEDRDLEEE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Katoh,M. (2004) Int. J. Oncol. 25 (5), 1495-1500 |
| Description of Target |
FOXP4 belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. FOXP4 may play a role in the development of tumors of the kidney and larynx.This gene belongs to subfamily P of the forkhead box (FOX) transcription factor family. Forkhead box transcription factors play important roles in the regulation of tissue- and cell type-specific gene transcription during both development and adulthood. Many members of the forkhead box gene family, including members of subfamily P, have roles in mammalian oncogenesis. This gene may play a role in the development of tumors of the kidney and larynx. Alternative splicing of this gene produces multiple transcript variants, some encoding different isoforms. |
| Protein Interactions |
SOX2; MKI67; SUMO2; UBC; FOXP1; FOXP4; FOXP2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXP4 (ARP39817_T100) antibody |
| Blocking Peptide |
For anti-FOXP4 (ARP39817_T100) antibody is Catalog # AAP39817 (Previous Catalog # AAPP21831) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FOXP4 |
| Uniprot ID |
Q8IW55 |
| Protein Name |
Forkhead box protein P4 |
| Protein Accession # |
NP_612466 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_138457 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXP4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 82%; Horse: 93%; Human: 100%; Mouse: 91%; Pig: 93%; Rabbit: 100%; Rat: 90% |
| Image 1 | Human Liver
 | Human Liver |
| | Image 2 | Human Raji
 | WB Suggested Anti-FOXP4 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Raji cell lysate |
|
|
