| Product Number |
ARP39726_T100 |
| Product Page |
www.avivasysbio.com/znf382-antibody-n-terminal-region-arp39726-t100.html |
| Name |
ZNF382 Antibody - N-terminal region (ARP39726_T100) |
| Protein Size (# AA) |
550 amino acids |
| Molecular Weight |
64kDa |
| NCBI Gene Id |
84911 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Zinc finger protein 382 |
| Alias Symbols |
KS1 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Luo,K., (2002) Biochem. Biophys. Res. Commun. 299 (4), 606-612 |
| Description of Target |
Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli.Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli (Gebelein et al., 1998).[supplied by OMIM]. |
| Protein Interactions |
UBC; TRIM28; CBX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF382 (ARP39726_T100) antibody |
| Blocking Peptide |
For anti-ZNF382 (ARP39726_T100) antibody is Catalog # AAP39726 (Previous Catalog # AAPP21751) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF382 |
| Uniprot ID |
Q96SR6 |
| Protein Name |
Zinc finger protein 382 |
| Protein Accession # |
NP_116214 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_032825 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF382 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 92%; Rat: 93% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF382 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate |
|
|
