Product Number |
ARP39726_T100 |
Product Page |
www.avivasysbio.com/znf382-antibody-n-terminal-region-arp39726-t100.html |
Name |
ZNF382 Antibody - N-terminal region (ARP39726_T100) |
Protein Size (# AA) |
550 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
84911 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
Zinc finger protein 382 |
Alias Symbols |
KS1 |
Peptide Sequence |
Synthetic peptide located within the following region: MPLQGSVSFKDVTVDFTQEEWQQLDPAQKALYRDVMLENYCHFVSVGFHM |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Luo,K., (2002) Biochem. Biophys. Res. Commun. 299 (4), 606-612 |
Description of Target |
Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli.Members of the C2H2 zinc finger transcription factor family, such as ZNF382, play key roles in the regulation of cell proliferation, differentiation, and apoptosis in response to a variety of stimuli (Gebelein et al., 1998).[supplied by OMIM]. |
Protein Interactions |
UBC; TRIM28; CBX1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF382 (ARP39726_T100) antibody |
Blocking Peptide |
For anti-ZNF382 (ARP39726_T100) antibody is Catalog # AAP39726 (Previous Catalog # AAPP21751) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF382 |
Uniprot ID |
Q96SR6 |
Protein Name |
Zinc finger protein 382 |
Protein Accession # |
NP_116214 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_032825 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF382 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 92%; Rat: 93% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF382 Antibody Titration: 1.25ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|