| Product Number |
ARP39679_P050 |
| Product Page |
www.avivasysbio.com/otp-antibody-c-terminal-region-arp39679-p050.html |
| Name |
OTP Antibody - C-terminal region (ARP39679_P050) |
| Protein Size (# AA) |
325 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
23440 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Orthopedia homeobox |
| Peptide Sequence |
Synthetic peptide located within the following region: PAFPGMVPASLPGPSNVSGSPQLCSSPDSSDVWRGTSIASLRRKALEHTV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Lin,X., (1999) Genomics 60 (1), 96-104 |
| Description of Target |
OTP is a member of the homeodomain (HD) family. HD family proteins are helix-turn-helix transcription factors that play key roles in the specification of cell fates. This protein may function during brain development.This gene encodes a member of the homeodomain (HD) family. HD family proteins are helix-turn-helix transcription factors that play key roles in the specification of cell fates. This protein may function during brain development. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-OTP (ARP39679_P050) antibody |
| Blocking Peptide |
For anti-OTP (ARP39679_P050) antibody is Catalog # AAP39679 (Previous Catalog # AAPP21704) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human OTP |
| Uniprot ID |
Q5XKR4 |
| Protein Name |
Homeobox protein orthopedia |
| Protein Accession # |
NP_115485 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_032109 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
OTP |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 |
 | 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/mL of the antibody was used in this experiment.
|
|
|
