| Product Number |
ARP39574_P050 |
| Product Page |
www.avivasysbio.com/foxl2-antibody-c-terminal-region-arp39574-p050.html |
| Name |
Foxl2 Antibody - C-terminal region (ARP39574_P050) |
| Protein Size (# AA) |
374 amino acids |
| Molecular Weight |
39kDa |
| NCBI Gene Id |
367152 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box L2 |
| Description |
|
| Alias Symbols |
Foxl2 |
| Peptide Sequence |
Synthetic peptide located within the following region: SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Foxl2 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Foxl2 (ARP39574_P050) antibody |
| Blocking Peptide |
For anti-Foxl2 (ARP39574_P050) antibody is Catalog # AAP39574 (Previous Catalog # AAPP21587) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D4A0S1 |
| Protein Name |
Protein Foxl2 Ensembl ENSRNOP00000023091 |
| Protein Accession # |
XP_001070279 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001070279 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Foxl2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Rat Liver
 | WB Suggested Anti-Foxl2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Rat Liver |
|
|
