Product Number |
ARP39574_P050 |
Product Page |
www.avivasysbio.com/foxl2-antibody-c-terminal-region-arp39574-p050.html |
Name |
Foxl2 Antibody - C-terminal region (ARP39574_P050) |
Protein Size (# AA) |
374 amino acids |
Molecular Weight |
39kDa |
NCBI Gene Id |
367152 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Forkhead box L2 |
Description |
|
Alias Symbols |
Foxl2 |
Peptide Sequence |
Synthetic peptide located within the following region: SPATAAPPAPAPTSAPGLQFACARQPELAMMHCSYWDHDSKTGALHSRLD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The function of Foxl2 remains unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-Foxl2 (ARP39574_P050) antibody |
Blocking Peptide |
For anti-Foxl2 (ARP39574_P050) antibody is Catalog # AAP39574 (Previous Catalog # AAPP21587) |
Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
Uniprot ID |
D4A0S1 |
Protein Name |
Protein Foxl2 Ensembl ENSRNOP00000023091 |
Protein Accession # |
XP_001070279 |
Purification |
Affinity Purified |
Nucleotide Accession # |
XM_001070279 |
Tested Species Reactivity |
Rat |
Gene Symbol |
Foxl2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Goat, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Goat: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Rat Liver
| WB Suggested Anti-Foxl2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Rat Liver |
|
|