PRDM13 Antibody - C-terminal region (ARP39506_T100)

• Product Number: ARP39506_T100
• Name: PRDM13 Antibody - C-terminal region (ARP39506_T100)
• Protein Size (# AA): 717 amino acids
• Molecular Weight: 75kDa
• NCBI Gene Id: 59336
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: PR domain containing 13
• Alias Symbols: PFM10, MU-MB-20.220
• Peptide Sequence: Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Behrends,U., (2003) Int. J. Cancer 106 (2), 244-251
• Description of Target: PRDM13 may be involved in transcriptional regulation.
• Protein Interactions: KDM5B;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PRDM13 (ARP39506_T100) antibody is Catalog # AAP39506 (Previous Catalog # AAPP23068)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM13
• Uniprot ID: Q9H4Q3
• Protein Name: PR domain zinc finger protein 13
• Sample Type Confirmation:

  PRDM13 is supported by BioGPS gene expression data to be expressed in Jurkat

• Protein Accession #: NP_067633
• Purification: Protein A purified
• Nucleotide Accession #: NM_021620
• Tested Species Reactivity: Human
• Gene Symbol: PRDM13
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 87%; Dog: 87%; Human: 100%; Mouse: 92%; Pig: 87%; Rabbit: 100%; Rat: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PRDM13 Antibody Titration: 1.25ug/ml
  Positive Control: Jurkat cell lysatePRDM13 is supported by BioGPS gene expression data to be expressed in Jurkat