PRDM13 antibody - C-terminal region (ARP39506_T100)
Data Sheet
Product Number ARP39506_T100
Product Page
Product Name PRDM13 antibody - C-terminal region (ARP39506_T100)
Size 100 ul
Gene Symbol PRDM13
Alias Symbols PFM10, MU-MB-20.220
Protein Size (# AA) 717 amino acids
Molecular Weight 75kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 59336
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name PR domain containing 13
Description This is a rabbit polyclonal antibody against PRDM13. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (
Peptide Sequence Synthetic peptide located within the following region: SLLAKAGDGPGAEPGYPPEPGDPKSDDSDVDVCFTDDQSDPEVGGGGERD
Target Reference Behrends,U., (2003) Int. J. Cancer 106 (2), 244-251
Description of Target PRDM13 may be involved in transcriptional regulation.
Protein Interactions KDM5B;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-PRDM13 (ARP39506_T100) antibody is Catalog # AAP39506 (Previous Catalog # AAPP23068)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human PRDM13
Complete computational species homology data Anti-PRDM13 (ARP39506_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express PRDM13.
Swissprot Id Q9H4Q3
Protein Name PR domain zinc finger protein 13
Sample Type Confirmation

PRDM13 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_067633
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express PRDM13.
Nucleotide Accession # NM_021620
Replacement Item This antibody may replace item sc-107963-R from Santa Cruz Biotechnology.
Conjugation Options

ARP39506_T100-FITC Conjugated

ARP39506_T100-HRP Conjugated

ARP39506_T100-Biotin Conjugated

CB Replacement sc-107963-R; sc-95476
Species Reactivity Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 87%; Dog: 87%; Human: 100%; Mouse: 92%; Pig: 87%; Rabbit: 100%; Rat: 92%
Image 1
Human Jurkat
WB Suggested Anti-PRDM13 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

PRDM13 is supported by BioGPS gene expression data to be expressed in Jurkat


AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 |