ZNF415 Antibody - C-terminal region (ARP39352_P050)

• Product Number: ARP39352_P050
• Name: ZNF415 Antibody - C-terminal region (ARP39352_P050)
• Protein Size (# AA): 555 amino acids
• Molecular Weight: 64kDa
• NCBI Gene Id: 55786
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Zinc finger protein 415
• Alias Symbols: Pact, ZfLp
• Peptide Sequence: Synthetic peptide located within the following region: SVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45
• Description of Target: ZNF415 is involved in transcriptional regulation. The transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppress the transcriptional activities of AP-1 and p53.
• Protein Interactions: KRTAP4-12; MTUS2; UBC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ZNF415 (ARP39352_P050) antibody is Catalog # AAP39352 (Previous Catalog # AAPP23426)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF415
• Uniprot ID: Q09FC8-5
• Protein Name: Zinc finger protein 415
• Protein Accession #: NP_060825
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018355
• Tested Species Reactivity: Human
• Gene Symbol: ZNF415
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 92%
• Image 1: Human Jurkat
  
  WB Suggested Anti-ZNF415 Antibody Titration: 0.2-1 ug/ml
  Positive Control: Jurkat cell lysate