Product Number |
ARP39352_P050 |
Product Page |
www.avivasysbio.com/znf415-antibody-c-terminal-region-arp39352-p050.html |
Name |
ZNF415 Antibody - C-terminal region (ARP39352_P050) |
Protein Size (# AA) |
555 amino acids |
Molecular Weight |
64kDa |
NCBI Gene Id |
55786 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Zinc finger protein 415 |
Alias Symbols |
Pact, ZfLp |
Peptide Sequence |
Synthetic peptide located within the following region: SVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPYKRN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
ZNF415 is involved in transcriptional regulation. The transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppress the transcriptional activities of AP-1 and p53. |
Protein Interactions |
KRTAP4-12; MTUS2; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-ZNF415 (ARP39352_P050) antibody |
Blocking Peptide |
For anti-ZNF415 (ARP39352_P050) antibody is Catalog # AAP39352 (Previous Catalog # AAPP23426) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF415 |
Uniprot ID |
Q09FC8-5 |
Protein Name |
Zinc finger protein 415 |
Protein Accession # |
NP_060825 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_018355 |
Tested Species Reactivity |
Human |
Gene Symbol |
ZNF415 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Zebrafish: 92% |
Image 1 | Human Jurkat
| WB Suggested Anti-ZNF415 Antibody Titration: 0.2-1 ug/ml Positive Control: Jurkat cell lysate |
|
|