website statistics
Product Datasheet: ARP38965_T100 - TRIM32 antibody - N-terminal region (ARP38965_T100) - Aviva Systems Biology
 
TRIM32 antibody - N-terminal region (ARP38965_T100)
Data Sheet
 
Product Number ARP38965_T100
Product Page www.avivasysbio.com/trim32-antibody-n-terminal-region-arp38965-t100.html
Product Name TRIM32 antibody - N-terminal region (ARP38965_T100)
Size 100 ul
Gene Symbol TRIM32
Alias Symbols HT2A, BBS11, TATIP, LGMD2H
Protein Size (# AA) 653 amino acids
Molecular Weight 72kDa
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
NCBI Gene Id 22954
Host Rabbit
Clonality Polyclonal
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Official Gene Full Name Tripartite motif containing 32
Description This is a rabbit polyclonal antibody against TRIM32. It was validated on Western Blot using a cell lysate as a positive control. Aviva Systems Biology strives to provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (info@avivasysbio.com).
Peptide Sequence Synthetic peptide located within the following region: MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEK
Target Reference Chiang,A.P., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (16), 6287-6292
Description of Target TRIM32 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. TRIM32 localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes.
Protein Interactions PTPN11; PDE9A; PTCD2; CLIP4; KCTD9; UBQLN1; TRIM32; RABAC1; ABI2; SCGB1A1; UBE2E1; UBE2D1; UBC; TP53; SDCBP; UBE2U; SYT6; MYCN; CEP250; CUL3; GPRASP2; GLIS2; YWHAB; TP73; UBE2D3; UBE2D2; HSP90AA1; SFN; YWHAQ; YWHAZ; YWHAH; YWHAG; YWHAE; NOTCH1; UBD; TOP1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Lead Time Domestic: within 1-2 days delivery International: 1-2 days
Blocking Peptide For anti-TRIM32 (ARP38965_T100) antibody is Catalog # AAP38965 (Previous Catalog # AAPY00774)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TRIM32
Complete computational species homology data Anti-TRIM32 (ARP38965_T100)
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express TRIM32.
Swissprot Id Q13049
Protein Name E3 ubiquitin-protein ligase TRIM32
Publications

Kudryashova, E., Wu, J., Havton, L. A. & Spencer, M. J. Deficiency of the E3 ubiquitin ligase TRIM32 in mice leads to a myopathy with a neurogenic component. Hum. Mol. Genet. 18, 1353-67 (2009). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 19155210

Streich, F. C., Ronchi, V. P., Connick, J. P. & Haas, A. L. Tripartite motif ligases catalyze polyubiquitin chain formation through a cooperative allosteric mechanism. J. Biol. Chem. 288, 8209-21 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 23408431

Protein Accession # NP_036342
Purification Protein A purified
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express TRIM32.
Nucleotide Accession # NM_012210
Replacement Item This antibody may replace item sc-134120 from Santa Cruz Biotechnology.
Conjugation Options

ARP38965_T100-FITC Conjugated

ARP38965_T100-HRP Conjugated

ARP38965_T100-Biotin Conjugated

CB Replacement sc-134120; sc-135588; sc-49265; sc-49266; sc-61714; sc-61715; sc-99011
Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Image 1
Human Jurkat
WB Suggested Anti-TRIM32 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
5754 Pacific Center Blvd., Suite 201 San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com