| Product Number |
ARP38961_T100 |
| Product Page |
www.avivasysbio.com/foxb1-antibody-n-terminal-region-arp38961-t100.html |
| Name |
FOXB1 Antibody - N-terminal region (ARP38961_T100) |
| Protein Size (# AA) |
324 amino acids |
| Molecular Weight |
35kDa |
| NCBI Gene Id |
27023 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Forkhead box B1 |
| Alias Symbols |
FKH5, HFKH-5 |
| Peptide Sequence |
Synthetic peptide located within the following region: MPRPGRNTYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mincheva,A., Unpublished |
| Description of Target |
FOXB1 is a winged helix/forkhead transcription factor. FOXB1 is specifically expressed in the developing central nervous system (CNS). Early embryonic FOXB1 expression is restricted to the mammiliary body region of the caudal hypothalamus, midbrain, hindbrain and spinal cord. FOXB1 may play a role in postnatal growth, lactation and CNS development. |
| Protein Interactions |
NOTCH2NL; KRTAP10-3; KRTAP10-8; KRT40; TRIM27; KRT31; PHF5A; COPB1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXB1 (ARP38961_T100) antibody |
| Blocking Peptide |
For anti-FOXB1 (ARP38961_T100) antibody is Catalog # AAP38961 (Previous Catalog # AAPY00770) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human FOXB1 |
| Uniprot ID |
Q99853 |
| Protein Name |
Forkhead box protein B1 |
| Protein Accession # |
NP_036314 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_012182 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXB1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 79%; Rat: 100%; Yeast: 80%; Zebrafish: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-FOXB1 Antibody Titration: 5.0ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate |
|
|
