GTF3C5 Antibody - C-terminal region (ARP38951_P050)

Data Sheet
 
Product Number ARP38951_P050
Product Page www.avivasysbio.com/gtf3c5-antibody-c-terminal-region-arp38951-p050.html
Name GTF3C5 Antibody - C-terminal region (ARP38951_P050)
Protein Size (# AA) 519 amino acids
Molecular Weight 60kDa
NCBI Gene Id 9328
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name General transcription factor IIIC, polypeptide 5, 63kDa
Alias Symbols TFIIIC63, TFiiiC2-63, TFIIICepsilon
Peptide Sequence Synthetic peptide located within the following region: SKRPALFSSSAKADGGKEQLTYESGEDEEDEEEEEEEEEDFKPSDGSENE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hsieh,Y.J., (1999) Mol. Cell. Biol. 19 (7), 4944-4952
Description of Target GTF3C5 is polypeptide 5 of general transcription factor IIIon Channel. Human transcription factor IIIon Channel (hTFIIIon Channel) is a multisubunit complex that directly recognizes promoter elements and recruits TFIIIB and RNA polymerase III.
Protein Interactions MDFI; NOTCH2NL; KRTAP10-3; KRT40; CEP250; VCP; UBC; ECT2; PAXIP1; SRA1; GTF3C6; PBRM1; GTF3C3; GTF3C4; GTF3C2; GTF3C1; CUL1; CUL3; SMARCAD1; tat; EP300; TCF4; TCF21; TAF10; BRF1; POLR3C; TBP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF3C5 (ARP38951_P050) antibody
Blocking Peptide For anti-GTF3C5 (ARP38951_P050) antibody is Catalog # AAP38951 (Previous Catalog # AAPY00760)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF3C5
Uniprot ID Q9Y5Q8
Protein Name General transcription factor 3C polypeptide 5
Protein Accession # NP_036219
Purification Affinity Purified
Nucleotide Accession # NM_012087
Tested Species Reactivity Human
Gene Symbol GTF3C5
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 77%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Human Intestine
Human Intestine
Image 2
Human HepG2
WB Suggested Anti-GTF3C5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com