| Product Number |
ARP38885_P050 |
| Product Page |
www.avivasysbio.com/znf16-antibody-c-terminal-region-arp38885-p050.html |
| Name |
ZNF16 Antibody - C-terminal region (ARP38885_P050) |
| Protein Size (# AA) |
682 amino acids |
| Molecular Weight |
76kDa |
| NCBI Gene Id |
7564 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 16 |
| Alias Symbols |
HZF1, KOX9 |
| Peptide Sequence |
Synthetic peptide located within the following region: GKAFSQRSVLIQHQRIHTGVKPYDCAACGKAFSQRSKLIKHQLIHTRE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dreier,B., (2000) J. Mol. Biol. 303 (4), 489-502 |
| Description of Target |
ZNF16 contains a C2H2 type of zinc finger, and thus may function as a transcription factor.The protein encoded by this gene contains a C2H2 type of zinc finger, and thus may function as a transcription factor. This gene is located in a region close to ZNF7/KOX4, a gene also encoding a zinc finger protein, on chromosome 8. Two alternatively spliced variants, encoding the same protein, have been identified. |
| Protein Interactions |
ZNF101; GORAB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF16 (ARP38885_P050) antibody |
| Blocking Peptide |
For anti-ZNF16 (ARP38885_P050) antibody is Catalog # AAP38885 (Previous Catalog # AAPP21091) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF16 |
| Uniprot ID |
P17020 |
| Protein Name |
Zinc finger protein 16 |
| Protein Accession # |
NP_008889 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006958 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF16 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 79%; Pig: 100%; Rabbit: 100%; Rat: 86% |
| Image 1 | Human Heart
 | WB Suggested Anti-ZNF16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart |
|
|
