TCEA1 Antibody - N-terminal region (ARP38858_T100)

Data Sheet
 
Product Number ARP38858_T100
Product Page www.avivasysbio.com/tcea1-antibody-n-terminal-region-arp38858-t100.html
Name TCEA1 Antibody - N-terminal region (ARP38858_T100)
Protein Size (# AA) 301 amino acids
Molecular Weight 34kDa
NCBI Gene Id 6917
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Transcription elongation factor A (SII), 1
Alias Symbols SII, TCEA, TF2S, GTF2S, TFIIS
Peptide Sequence Synthetic peptide located within the following region: MEDEVVRFAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Kimura,K., (2006) Genome Res. 16 (1), 55-65
Description of Target TCEA1 is necessary for efficient RNA polymerase II transcription elongation past template-encoded arresting sites. TCEA1 has a role in suppression of transient pausing, which is the most important contribution of TCEA1 to elongation from a stall position. TCEA1 fuse to PLAG1 protein which is overexpressed in epithelial, myoepithelial, and mesenchymal-like tumor cells in tumors.
Protein Interactions UBC; SORD; PGD; LDHA; CSE1L; BCCIP; CHORDC1; TBP; MCM5; MCM3; MCM2; GTF2H1; GTF2F1; GTF2E1; GTF2B; CDK8; MED26; POLR2C; NAA16; RBM25; SF3B2; UBAC1; POLR2A; APP; PAF1; UBR5; CDK9; LEO1; WDR61; CDC73; RTF1; CTR9; POLR2B; DDX5; INTS1; SF3B3; SNRNP200; SF3A1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TCEA1 (ARP38858_T100) antibody
Blocking Peptide For anti-TCEA1 (ARP38858_T100) antibody is Catalog # AAP38858 (Previous Catalog # AAPP21065)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TCEA1
Uniprot ID P23193
Protein Name Transcription elongation factor A protein 1
Protein Accession # NP_006747
Purification Protein A purified
Nucleotide Accession # NM_006756
Tested Species Reactivity Human
Gene Symbol TCEA1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human K562
WB Suggested Anti-TCEA1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: K562 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com