| Product Number |
ARP38756_P050 |
| Product Page |
www.avivasysbio.com/peg3-antibody-c-terminal-region-arp38756-p050.html |
| Name |
PEG3 Antibody - C-terminal region (ARP38756_P050) |
| Protein Size (# AA) |
1588 amino acids |
| Molecular Weight |
181kDa |
| NCBI Gene Id |
5178 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Paternally expressed 3 |
| Alias Symbols |
PW1, ZNF904, ZSCAN24, ZKSCAN22 |
| Peptide Sequence |
Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Dowdy,S.C., et al., (2005) Gynecol. Oncol. 99 (1), 126-134 |
| Description of Target |
PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells. |
| Protein Interactions |
PEG3; ALB; USP7; TRAF2; SIAH2; SIAH1; BRCA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PEG3 (ARP38756_P050) antibody |
| Blocking Peptide |
For anti-PEG3 (ARP38756_P050) antibody is Catalog # AAP38756 (Previous Catalog # AAPP20962) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human PEG3 |
| Uniprot ID |
Q9GZU2 |
| Protein Name |
Paternally-expressed gene 3 protein |
| Sample Type Confirmation |
PEG3 is strongly supported by BioGPS gene expression data to be expressed in A204 |
| Protein Accession # |
NP_006201 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006210 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PEG3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93% |
| Image 1 | Human A204
 | WB Suggested Anti-PEG3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: A204 cell lysatePEG3 is strongly supported by BioGPS gene expression data to be expressed in Human A204 cells |
|
