| Product Number |
ARP38741_P050 |
| Product Page |
www.avivasysbio.com/neurod2-antibody-c-terminal-region-arp38741-p050.html |
| Name |
NEUROD2 Antibody - C-terminal region (ARP38741_P050) |
| Protein Size (# AA) |
382 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
4761 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Neuronal differentiation 2 |
| Alias Symbols |
NDRF, DEE72, EIEE72, bHLHa1 |
| Peptide Sequence |
Synthetic peptide located within the following region: PGSRPTGHGLVFGSSAVRGGVHSENLLSYDMHLHHDRGPMYEELNAFFHN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Westerman,B.A., et al., (2004) Biochim. Biophys. Acta 1676 (1), 96-103 |
| Description of Target |
NEUROD2 is a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of NEUROD2 can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. NEUROD2 can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates.This gene encodes a member of the neuroD family of neurogenic basic helix-loop-helix (bHLH) proteins. Expression of this gene can induce transcription from neuron-specific promoters, such as the GAP-43 promoter, which contain a specific DNA sequence known as an E-box. The product of the human gene can induce neurogenic differentiation in non-neuronal cells in Xenopus embryos, and is thought to play a role in the determination and maintenance of neuronal cell fates. |
| Protein Interactions |
TK1; PKN1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-NEUROD2 (ARP38741_P050) antibody |
| Blocking Peptide |
For anti-NEUROD2 (ARP38741_P050) antibody is Catalog # AAP38741 (Previous Catalog # AAPP20947) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human NEUROD2 |
| Uniprot ID |
Q15784 |
| Protein Name |
Neurogenic differentiation factor 2 |
| Protein Accession # |
NP_006151 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006160 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
NEUROD2 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Cerebellum
 | WB Suggested Anti-NEUROD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human cerebellum |
|
