Product Number |
ARP38649_T100 |
Product Page |
www.avivasysbio.com/sox3-antibody-c-terminal-region-arp38649-t100.html |
Name |
SOX3 Antibody - C-terminal region (ARP38649_T100) |
Protein Size (# AA) |
446 amino acids |
Molecular Weight |
45kDa |
NCBI Gene Id |
6658 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
1.0 mg/ml |
Gene Full Name |
SRY (sex determining region Y)-box 3 |
Alias Symbols |
PHP, GHDX, MRGH, PHPX, SOXB |
Peptide Sequence |
Synthetic peptide located within the following region: QRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Savare,J., et al., (2005) Mol. Biol. Cell 16 (6), 2660-2669 |
Description of Target |
SOX3 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency. |
Protein Interactions |
TRRAP; SUMO1; SUMO2; PAX6; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SOX3 (ARP38649_T100) antibody |
Blocking Peptide |
For anti-SOX3 (ARP38649_T100) antibody is Catalog # AAP38649 (Previous Catalog # AAPP20839) |
Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human SOX3 |
Uniprot ID |
P41225 |
Protein Name |
Transcription factor SOX-3 |
Sample Type Confirmation |
SOX3 is supported by BioGPS gene expression data to be expressed in MCF7 |
Protein Accession # |
NP_005625 |
Purification |
Protein A purified |
Nucleotide Accession # |
NM_005634 |
Tested Species Reactivity |
Human |
Gene Symbol |
SOX3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 77%; Zebrafish: 77% |
Image 1 | Human MCF-7
| WB Suggested Anti-SOX3 Antibody Titration: 1.25ug/ml ELISA Titer: 1:312500 Positive Control: MCF7 cell lysateSOX3 is supported by BioGPS gene expression data to be expressed in MCF7 |
|