SOX3 Antibody - C-terminal region (ARP38649_T100)

Data Sheet
 
Product Number ARP38649_T100
Product Page www.avivasysbio.com/sox3-antibody-c-terminal-region-arp38649-t100.html
Name SOX3 Antibody - C-terminal region (ARP38649_T100)
Protein Size (# AA) 446 amino acids
Molecular Weight 45kDa
NCBI Gene Id 6658
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name SRY (sex determining region Y)-box 3
Alias Symbols PHP, GHDX, MRGH, PHPX, SOXB
Peptide Sequence Synthetic peptide located within the following region: QRACLGDLRDMISMYLPPGGDAADAASPLPGGRLHGVHQHYQGAGTAVNG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Savare,J., et al., (2005) Mol. Biol. Cell 16 (6), 2660-2669
Description of Target SOX3 is a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene have been associated with X-linked mental retardation with growth hormone deficiency.
Protein Interactions TRRAP; SUMO1; SUMO2; PAX6;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SOX3 (ARP38649_T100) antibody
Blocking Peptide For anti-SOX3 (ARP38649_T100) antibody is Catalog # AAP38649 (Previous Catalog # AAPP20839)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SOX3
Uniprot ID P41225
Protein Name Transcription factor SOX-3
Sample Type Confirmation

SOX3 is supported by BioGPS gene expression data to be expressed in MCF7

Protein Accession # NP_005625
Purification Protein A purified
Nucleotide Accession # NM_005634
Tested Species Reactivity Human
Gene Symbol SOX3
Predicted Species Reactivity Human, Mouse, Rat, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 77%; Zebrafish: 77%
Image 1
Human MCF-7
WB Suggested Anti-SOX3 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysateSOX3 is supported by BioGPS gene expression data to be expressed in MCF7
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com