CBFA2T3 Antibody - N-terminal region (ARP38578_T100)

Data Sheet
 
Product Number ARP38578_T100
Product Page www.avivasysbio.com/cbfa2t3-antibody-n-terminal-region-arp38578-t100.html
Name CBFA2T3 Antibody - N-terminal region (ARP38578_T100)
Protein Size (# AA) 545 amino acids
Molecular Weight 60kDa
NCBI Gene Id 863
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Core-binding factor, runt domain, alpha subunit 2; translocated to, 3
Alias Symbols ETO2, MTG16, MTGR2, ZMYND4, RUNX1T3
Peptide Sequence Synthetic peptide located within the following region: MPASRLRDRAASSASGSTCGSMSQTHPVLESGLLASAGCSAPRGPRKGGP
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of CBFA2T3. In addition, CBFA2T3 is a putative breast tumor suppressor.
Protein Interactions Zbtb38; Zbtb4; ZBTB33; GMEB2; SEC24A; MATN2; ZBTB47; UBC; RUNX1; TAL1; TRIM33; SIN3B; NCOR1; HDAC3; CBFA2T3; CBFA2T2; HDAC1; PRKAR2A; RUNX1T1; LDB1; TCF3; HDAC8; HDAC6; HDAC2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CBFA2T3 (ARP38578_T100) antibody
Blocking Peptide For anti-CBFA2T3 (ARP38578_T100) antibody is Catalog # AAP38578 (Previous Catalog # AAPP20768)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CBFA2T3
Uniprot ID O75107
Protein Name Protein CBFA2T3
Sample Type Confirmation

CBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # BAA31276
Purification Protein A purified
Nucleotide Accession # NM_005187
Tested Species Reactivity Human
Gene Symbol CBFA2T3
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%
Image 1
Human Jurkat
WB Suggested Anti-CBFA2T3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysateCBFA2T3 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com