NRF1 Antibody - C-terminal region (ARP38543_T100)

Data Sheet
 
Product Number ARP38543_T100
Product Page www.avivasysbio.com/nrf1-antibody-c-terminal-region-arp38543-t100.html
Name NRF1 Antibody - C-terminal region (ARP38543_T100)
Protein Size (# AA) 522 amino acids
Molecular Weight 56kDa
NCBI Gene Id 4899
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear respiratory factor 1
Alias Symbols ALPHA-PAL
Peptide Sequence Synthetic peptide located within the following region: IVLSGETAAAVGALTGVQDANGLFMADRAGRKWILTDKATGLVQIPVSMY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Chang,W.T., (2005) Biochem. Biophys. Res. Commun. 334 (1), 199-206
Description of Target NRF1 is a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth.This gene encodes a phosphorylated nuclear protein with a bZIP domain. This protein homodimerizes and functions as a transcription factor that activates the expression of some key metabolic genes regulating cellular growth and nuclear genes required for respiration, heme biosynthesis, and mitochondrial DNA transcription and replication. The protein has also been associated with the regulation of neurite outgrowth. Alternate transcriptional splice variants, which encode the same protein, have been characterized. Additional variants encoding different protein isoforms have been described but they have not been fully characterized.
Protein Interactions POGZ; TRAF2; SP4; FHL2; DYNLL1; CSNK2B; CSNK2A1; UBC; HHV8GK18_gp81; CEBPB; PARP1; PPRC1; MAFF; PPARGC1A; Dynlt1b; CDK1; MRPL57; TFAM;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NRF1 (ARP38543_T100) antibody
Blocking Peptide For anti-NRF1 (ARP38543_T100) antibody is Catalog # AAP38543 (Previous Catalog # AAPP20734)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NRF1
Uniprot ID Q96AN2
Protein Name NRF1 protein EMBL AAH16925.1
Protein Accession # NP_005002
Purification Protein A purified
Nucleotide Accession # NM_005011
Tested Species Reactivity Human
Gene Symbol NRF1
Predicted Species Reactivity Human, Rat
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Rat: 91%
Image 1
Human Lung
Human Lung
Image 2
Transfected 293T
WB Suggested Anti-NRF1 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com