| Product Number |
ARP38482_P050 |
| Product Page |
www.avivasysbio.com/hoxb7-antibody-c-terminal-region-arp38482-p050.html |
| Name |
HOXB7 Antibody - C-terminal region (ARP38482_P050) |
| Protein Size (# AA) |
217 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
3217 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Homeobox B7 |
| Alias Symbols |
HOX2, HOX2C, HHO.C1, Hox-2.3 |
| Peptide Sequence |
Synthetic peptide located within the following region: RYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Makiyama,K., (2005) Oncol. Rep. 13 (4), 673-679 |
| Description of Target |
HOXB7 is a member of the Antp homeobox family and is a protein with a homeobox DNA-binding domain. The nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma.This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. |
| Protein Interactions |
CLK3; IRAK3; APP; XRCC5; PRKDC; XRCC6; PARP1; CREBBP; GMNN; EP300; PKNOX1; NFKBIA; HOXB6; CSNK2A1; PBX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-HOXB7 (ARP38482_P050) antibody |
| Blocking Peptide |
For anti-HOXB7 (ARP38482_P050) antibody is Catalog # AAP38482 (Previous Catalog # AAPP23191) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human HOXB7 |
| Uniprot ID |
P09629 |
| Protein Name |
Homeobox protein Hox-B7 |
| Protein Accession # |
NP_004493 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_004502 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
HOXB7 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Transfected 293T
 | WB Suggested Anti-HOXB7 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T |
|
|
