NR5A2 Antibody - N-terminal region (ARP38386_T100)

Data Sheet
 
Product Number ARP38386_T100
Product Page www.avivasysbio.com/nr5a2-antibody-n-terminal-region-arp38386-t100.html
Name NR5A2 Antibody - N-terminal region (ARP38386_T100)
Protein Size (# AA) 541 amino acids
Molecular Weight 61kDa
NCBI Gene Id 2494
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name Nuclear receptor subfamily 5, group A, member 2
Alias Symbols B1F, CPF, FTF, B1F2, LRH1, LRH-1, FTZ-F1, hB1F-2, FTZ-F1beta
Peptide Sequence Synthetic peptide located within the following region: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGY
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Lee,Y.K., (2006) J. Biol. Chem. 281 (12), 7850-7855
Description of Target NR5A2 binds to the sequence element 5'-AACGACCGACCTTGAG-3' of the enhancer II of hepatitis B virus genes, a critical cis-element of their expression and regulation. It may be responsable for the liver-specific activity of enhancer II, probably in combination with other hepatocyte transcription factors. It is a key regulator of cholesterol 7-alpha-hydroxylase gene (CYP7A) expression in liver. It may also contribute to the regulation of pancreas-specific genes and play important roles in embryonic development.
Protein Interactions NSD1; NCOA1; CREB1; UBE2I; RAD54L2; NR0B2; GPS2; ILF3; PNRC2; COPS5; PNRC1; BCKDK; NRIP1; SRC; NPPA; FTH1; ALB; SUMO1; PPARGC1A; POLR2D; EDF1; SMARCD3; PROX1; Ncoa3; Ptpn6; CTNNB1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-NR5A2 (ARP38386_T100) antibody
Blocking Peptide For anti-NR5A2 (ARP38386_T100) antibody is Catalog # AAP38386 (Previous Catalog # AAPP20572)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human NR5A2
Uniprot ID O00482
Protein Name Nuclear receptor subfamily 5 group A member 2
Protein Accession # NP_995582
Purification Protein A purified
Nucleotide Accession # NM_205860
Tested Species Reactivity Human
Gene Symbol NR5A2
Predicted Species Reactivity Human, Rat, Cow, Guinea Pig, Pig, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Guinea Pig: 86%; Human: 100%; Pig: 92%; Rat: 93%; Sheep: 100%
Image 1
Human HepG2
WB Suggested Anti-NR5A2 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com