| Product Number |
ARP38320_P050 |
| Product Page |
www.avivasysbio.com/znf264-antibody-c-terminal-region-arp38320-p050.html |
| Name |
ZNF264 Antibody - C-terminal region (ARP38320_P050) |
| Protein Size (# AA) |
627 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
9422 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 264 |
| Peptide Sequence |
Synthetic peptide located within the following region: SGQTSVTLRELLLGKDFLNVTTEANILPEETSSSASDQPYQRETPQVSSL |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954 |
| Description of Target |
ZNF264 may be involved in transcriptional regulation. |
| Protein Interactions |
KRTAP10-3; KRTAP10-5; KRTAP10-1; KRTAP10-9; TRIM41; NDEL1; ZNF175; MDFI; DVL3; CBX5; UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF264 (ARP38320_P050) antibody |
| Blocking Peptide |
For anti-ZNF264 (ARP38320_P050) antibody is Catalog # AAP38320 (Previous Catalog # AAPP23131) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF264 |
| Uniprot ID |
O43296 |
| Protein Name |
Zinc finger protein 264 |
| Sample Type Confirmation |
ZNF264 is supported by BioGPS gene expression data to be expressed in Jurkat |
| Protein Accession # |
NP_003408 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_003417 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF264 |
| Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Rabbit |
| Application |
IHC, WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 79%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 79% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-ZNF264 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysateZNF264 is supported by BioGPS gene expression data to be expressed in Jurkat |
| | Image 2 | Human Lung
 | Rabbit Anti-ZNF264 antibody
Catalog Number: ARP38320
Paraffin Embedded Tissue: Human Lung
cell Cellular Data: alveolar cell
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X |
|
|
