LMX1B Antibody - C-terminal region (ARP38140_T100)

• Product Number: ARP38140_T100
• Name: LMX1B Antibody - C-terminal region (ARP38140_T100)
• Protein Size (# AA): 372 amino acids
• Molecular Weight: 42kDa
• NCBI Gene Id: 4010
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: LIM homeobox transcription factor 1, beta
• Alias Symbols: NPS1, FSGS10, LMX1.2
• Peptide Sequence: Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Bongers,E.M., et al., (2005) Eur. J. Hum. Genet. 13 (8), 935-946
• Description of Target: LMX1B is essential for the specification of dorsal limb fate at both the zeugopodal and autopodal levels. Defects in LMX1B are the cause of nail-patella syndrome (NPS) also knowan as Onychoosteodysplasia.
• Protein Interactions: LDB1; APP; SSBP3; TCF3;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-LMX1B (ARP38140_T100) antibody is Catalog # AAP38140 (Previous Catalog # AAPP20316)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human LMX1B
• Uniprot ID: Q6ISC9
• Protein Name: LIM homeobox transcription factor 1-beta
• Protein Accession #: NP_002307
• Purification: Protein A purified
• Nucleotide Accession #: NM_002316
• Tested Species Reactivity: Human
• Gene Symbol: LMX1B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human Muscle
  
  WB Suggested Anti-LMX1B Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:312500
  Positive Control: Human Muscle