GTF2H4 Antibody - C-terminal region (ARP38047_T100)

Data Sheet
 
Product Number ARP38047_T100
Product Page www.avivasysbio.com/gtf2h4-antibody-c-terminal-region-arp38047-t100.html
Name GTF2H4 Antibody - C-terminal region (ARP38047_T100)
Protein Size (# AA) 462 amino acids
Molecular Weight 52kDa
Subunit 4
NCBI Gene Id 2968
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name General transcription factor IIH, polypeptide 4, 52kDa
Alias Symbols P52, TFB2, TFIIH
Peptide Sequence Synthetic peptide located within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Weber,A., (2005) Mol. Cell. Biol. 25 (1), 147-161
Description of Target GTF2H4 belongs to the TFB2 family. It is a component of the core-TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II.
Protein Interactions UBC; CDK7; RNF11; TP53; MNAT1; GTF2H3; GTF2H2; GTF2H1; ERCC3; CCNH; XBP1P1; MYC; GTF2E1; ERCC5; MED21; BTAF1; TBP; POLR2A; GTF2F1; GTF2B; BRCA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GTF2H4 (ARP38047_T100) antibody
Blocking Peptide For anti-GTF2H4 (ARP38047_T100) antibody is Catalog # AAP38047 (Previous Catalog # AAPP23288)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human GTF2H4
Uniprot ID Q92759
Protein Name General transcription factor IIH subunit 4
Protein Accession # NP_001508
Purification Protein A purified
Nucleotide Accession # NM_001517
Tested Species Reactivity Human
Gene Symbol GTF2H4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 87%
Image 1
HepG2
Host: Rabbit
Target Name: GTF2H4
Sample Type: HepG2
Antibody Dilution: 1.0ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com