| Product Number |
ARP38028_P050 |
| Product Page |
www.avivasysbio.com/elf4-antibody-n-terminal-region-arp38028-p050.html |
| Name |
ELF4 Antibody - N-terminal region (ARP38028_P050) |
| Protein Size (# AA) |
663 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
2000 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
E74-like factor 4 (ets domain transcription factor) |
| Alias Symbols |
MEF, ELFR |
| Peptide Sequence |
Synthetic peptide located within the following region: MAITLQPSDLIFEFASNGMDDDIHQLEDPSVFPAVIVEQVPYPDLLHLYS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Cho,J.Y., (2004) J. Biol. Chem. 279 (19), 19512-19522 |
| Description of Target |
ELF4 contains 1 ETS DNA-binding domain and belongs to the ETS family. It is transcriptional activator that binds to DNA sequences containing the consensus 5'-WGGA-3'. It transactivates promoters of the hematopoietic growth factor genes CSF2, IL3, IL8, and of the bovine lysozyme gene. It acts synergistically with RUNX1 to transactivate the IL3 promoter and also transactivates the PRF1 promoter in natural killer (NK) cells. ELF4 plays a role in the development and function of NK and NK T-cells and in innate immunity. |
| Protein Interactions |
NPM1; SET; CASP4; UBC; PML; SKP2; KDM5B; FBXO4; FBXO7; UBB; RUNX1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ELF4 (ARP38028_P050) antibody |
| Blocking Peptide |
For anti-ELF4 (ARP38028_P050) antibody is Catalog # AAP38028 (Previous Catalog # AAPP20204) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ELF4 |
| Uniprot ID |
Q99607 |
| Protein Name |
ETS-related transcription factor Elf-4 |
| Protein Accession # |
NP_001412 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001421 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ELF4 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Liver
 | WB Suggested Anti-ELF4 Antibody Titration: 2 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
|
