PRDM1 Antibody - N-terminal region (ARP38013_T100)

Data Sheet
 
Product Number ARP38013_T100
Product Page www.avivasysbio.com/prdm1-antibody-n-terminal-region-arp38013-t100.html
Name PRDM1 Antibody - N-terminal region (ARP38013_T100)
Protein Size (# AA) 789 amino acids
Molecular Weight 88kDa
NCBI Gene Id 639
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name PR domain containing 1, with ZNF domain
Alias Symbols BLIMP1, PRDI-BF1
Peptide Sequence Synthetic peptide located within the following region: MKMDMEDADMTLWTEAEFEEKCTYIVNDHPWDSGADGGTSVQAEASLPRN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Miyajima,N., et al., (2006) J. Immunol. 176 (7), 4042-4050
Description of Target PRDM1 is a protein that acts as a repressor of beta-interferon gene expression. The protein binds specifically to the PRDI (positive regulatory domain I element) of the beta-IFN gene promoter. Transcription of this gene increases upon virus induction. Two alternatively spliced transcript variants that encode different isoforms have been reported.
Protein Interactions PRMT5; SENP1; EHMT2; PIAS1; SUMO1; IRF2; IRF1; HDAC2; HDAC1; HIST1H1A; MS4A1; HSP90AA1; ATXN1; ELAVL1; KDM1A; IRF4; TLE2; TLE1; AES; PRMT7; HIST2H3A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PRDM1 (ARP38013_T100) antibody
Blocking Peptide For anti-PRDM1 (ARP38013_T100) antibody is Catalog # AAP38013 (Previous Catalog # AAPP20186)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human PRDM1
Uniprot ID O75626
Protein Name PR domain zinc finger protein 1
Protein Accession # NP_001189
Purification Protein A purified
Nucleotide Accession # NM_001198
Tested Species Reactivity Human
Gene Symbol PRDM1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 83%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-PRDM1 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com