RFX5 Antibody - N-terminal region (ARP37992_T100)

• Product Number: ARP37992_T100
• Name: RFX5 Antibody - N-terminal region (ARP37992_T100)
• Protein Size (# AA): 616 amino acids
• Molecular Weight: 68kDa
• NCBI Gene Id: 5993
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: Regulatory factor X, 5 (influences HLA class II expression)
• Peptide Sequence: Synthetic peptide located within the following region: MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Nagarajan,U.M., (2004) J. Immunol. 173 (1), 410-419
• Description of Target: RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. RFX is a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined.
• Protein Interactions: UBC; MRPL53; SLIRP; SRPRB; CDV3; LSM7; RPS19; RBMS1; NDUFA7; NDUFA2; ANKRA2; RFXANK; MLLT1; HDAC4; CIITA; HDAC2; RFXAP;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-RFX5 (ARP37992_T100) antibody is Catalog # AAP37992 (Previous Catalog # AAPP20094)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RFX5
• Uniprot ID: P48382
• Protein Name: DNA-binding protein RFX5
• Protein Accession #: NP_001020774
• Purification: Protein A purified
• Nucleotide Accession #: NM_001025603
• Tested Species Reactivity: Human
• Gene Symbol: RFX5
• Predicted Species Reactivity: Human, Rat, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 86%; Rat: 79%
• Image 1: Transfected 293T
  
  WB Suggested Anti-RFX5 Antibody Titration: 2.5ug/ml
  ELISA Titer: 1:1562500
  Positive Control: Transfected 293T