WT1 Antibody - middle region (ARP37989_P050)

Data Sheet
 
Product Number ARP37989_P050
Product Page www.avivasysbio.com/wt1-antibody-middle-region-arp37989-p050.html
Name WT1 Antibody - middle region (ARP37989_P050)
Protein Size (# AA) 514 amino acids
Molecular Weight 49 kDa
NCBI Gene Id 7490
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Wilms tumor 1
Alias Symbols GUD, AWT1, WAGR, WT33, NPHS4, WIT-2
Peptide Sequence Synthetic peptide located within the following region: DHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQLA
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ruteshouser,E.C., (2008) Genes Chromosomes Cancer 47 (6), 461-470
Description of Target WT1 is a transcription factor that contains four zinc-finger motifs at the C-terminus and a proline/glutamine-rich DNA-binding domain at the N-terminus. It has an essential role in the normal development of the urogenital system, and it is mutated in a sm
Protein Interactions KRTAP10-3; KRTAP10-8; KRT40; EGR1; MDM2; DVL3; CIAO1; TP53; HSPA4; TAOK1; NPM3; ZNF205; SUZ12; MEN1; EZH2; DNMT1; WTIP; WTAP; PAWR; UBE2I; TP63; FHL2; TP73; PRKACA; CREBBP; U2AF2; PAX2; AREG;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Enhanced Validation
WBY
SPR
YCHAROS
Datasheets/Manuals Printable datasheet for anti-WT1 (ARP37989_P050) antibody
Additional Information IHC Information: Placenta
IHC Information: Testis
Blocking Peptide For anti-WT1 (ARP37989_P050) antibody is Catalog # AAP37989 (Previous Catalog # AAPP20091)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human WT1
Uniprot ID P19544
Protein Name Wilms tumor protein
Protein Accession # NP_077742
Purification Affinity Purified
Nucleotide Accession # NM_024424
Tested Species Reactivity Human, Mouse
Gene Symbol WT1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish
Application IHC, WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Testis
Human Testis
Image 2
Mouse Brain
Host: Mouse
Target Name: WT1
Sample Tissue: Mouse Brain
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com