| Product Number |
ARP37852_T100 |
| Product Page |
www.avivasysbio.com/alx3-antibody-n-terminal-region-arp37852-t100.html |
| Name |
ALX3 Antibody - N-terminal region (ARP37852_T100) |
| Protein Size (# AA) |
343 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
11694 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
1.0 mg/ml |
| Gene Full Name |
Aristaless-like homeobox 3 |
| Peptide Sequence |
Synthetic peptide located within the following region: MDPERCAPFSVGPAAGPYAAAGDEAPGPQGTPDAAPHLHPAPPRGPRLSR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Yamada,R., et al., (2004) Dev. Biol. 274 (2), 295-307 |
| Description of Target |
Mouse Alx3 is a homeobox gene that is related to the Drosophila aristaless gene and to a group of vertebrate genes including Prx1, Prx2, Cart1, and Alx4. The protein encoded contains a diverged variant of a conserved peptide sequence present near the carboxyl terminus of at least 15 different paired-class-homeodomain proteins. Alx3 is expressed in mouse embryos from 8 days of gestation onward in a characteristic pattern, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. |
| Protein Interactions |
Jdp2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ALX3 (ARP37852_T100) antibody |
| Blocking Peptide |
For anti-ALX3 (ARP37852_T100) antibody is Catalog # AAP37852 (Previous Catalog # AAPP09975) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of mouse ALX3 |
| Uniprot ID |
O70137 |
| Protein Name |
Homeobox protein aristaless-like 3 |
| Protein Accession # |
NP_031467 |
| Purification |
Protein A purified |
| Nucleotide Accession # |
NM_007441 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
ALX3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Guinea Pig: 77%; Human: 79%; Mouse: 100%; Rat: 93% |
| Image 1 | Mouse NIH-3T3
 | WB Suggested Anti-ALX3 Antibody Titration: 2.5ug/ml
ELISA Titer: 1:1562500
Positive Control: NIH/3T3 cell lysate |
|
|
