| Product Number |
ARP37812_P050 |
| Product Page |
www.avivasysbio.com/zfp62-antibody-middle-region-arp37812-p050.html |
| Name |
ZFP62 Antibody - middle region (ARP37812_P050) |
| Protein Size (# AA) |
726 amino acids |
| Molecular Weight |
80kDa |
| NCBI Gene Id |
92379 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Zinc finger protein 62 homolog (mouse) |
| Alias Symbols |
ZET, ZNF755 |
| Peptide Sequence |
Synthetic peptide located within the following region: HKRIHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEKPYECDECGKAFIT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
ZFP62 may play a role in differentiating skeletal muscle. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZFP62 (ARP37812_P050) antibody |
| Blocking Peptide |
For anti-ZFP62 (ARP37812_P050) antibody is Catalog # AAP37812 (Previous Catalog # AAPP08890) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human ZFP62 |
| Uniprot ID |
Q8NB50 |
| Protein Accession # |
XP_936733 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_931640 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZFP62 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
| Image 1 | Human 293T
 | WB Suggested Anti-ZFP62 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate |
|
|
