DDX46 Antibody - C-terminal region (ARP37717_T100)

Data Sheet
 
Product Number ARP37717_T100
Product Page www.avivasysbio.com/ddx46-antibody-c-terminal-region-arp37717-t100.html
Name DDX46 Antibody - C-terminal region (ARP37717_T100)
Protein Size (# AA) 1031 amino acids
Molecular Weight 113kDa
NCBI Gene Id 9879
Host Rabbit
Clonality Polyclonal
Concentration 1.0 mg/ml
Gene Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Alias Symbols Prp5, PRPF5
Peptide Sequence Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Xu,Y.Z., et al., (2004) EMBO J. 23 (2), 376-385
Description of Target DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.
Protein Interactions HUWE1; UBC; RPA3; RPA2; RPA1; PRPF40A; APBB1; SRPK2; LMNA; TPM2; PNLIPRP2; SMIM20; GEMIN5; SF3A3; SRSF11; CUL3; SIRT7; SF3A2; ELAVL1; SUMO2; Sf3a1; TCEA1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DDX46 (ARP37717_T100) antibody
Blocking Peptide For anti-DDX46 (ARP37717_T100) antibody is Catalog # AAP37717 (Previous Catalog # AAPP09049)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human DDX46
Uniprot ID Q7L014
Protein Name Probable ATP-dependent RNA helicase DDX46
Sample Type Confirmation

DDX46 is supported by BioGPS gene expression data to be expressed in Jurkat

Protein Accession # NP_055644
Purification Protein A purified
Nucleotide Accession # NM_014829
Tested Species Reactivity Human
Gene Symbol DDX46
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Jurkat
WB Suggested Anti-DDX46 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: Jurkat cell lysateDDX46 is supported by BioGPS gene expression data to be expressed in Jurkat
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com