SCN3B Antibody - N-terminal region (ARP37699_P050)

• Product Number: ARP37699_P050
• Name: SCN3B Antibody - N-terminal region (ARP37699_P050)
• Protein Size (# AA): 215 amino acids
• Molecular Weight: 24kDa
• Subunit: beta-3
• NCBI Gene Id: 55800
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Sodium channel, voltage-gated, type III, beta subunit
• Description:
  View product citations for SCN3B Antibody - N-terminal region (ARP37699_P050) on CiteAb
• Alias Symbols: SCNB3, ATFB16, BRGDA7, HSA243396
• Peptide Sequence: Synthetic peptide located within the following region: RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Kimura,K., et al., (2006) Genome Res. 16 (1), 55-65
• Description of Target: SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
• Protein Interactions: NFASC;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-SCN3B (ARP37699_P050) antibody is Catalog # AAP37699 (Previous Catalog # AAPP09033)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SCN3B
• Uniprot ID: Q9NY72
• Protein Name: Sodium channel subunit beta-3
• Publications:

  Ho, C., Zhao, J., Malinowski, S., Chahine, M. & O’Leary, M. E. Differential expression of sodium channel beta subunits in dorsal root ganglion sensory neurons. J. Biol. Chem. 287, 15044-53 (2012). 22408255

  Hu, D. et al. A mutation in the beta 3 subunit of the cardiac sodium channel associated with Brugada ECG phenotype. Circ. Cardiovasc. Genet. 2, 270-8 (2009). 20031595

  Modulation of microRNA-375 expression alters voltage-gated Na(+) channel properties and exocytosis in insulin-secreting cells. Acta Physiol (Oxf). 213, 882-92 (2015). 25627423

• Protein Accession #: NP_060870
• Purification: Affinity Purified
• Nucleotide Accession #: NM_018400
• Tested Species Reactivity: Human
• Gene Symbol: SCN3B
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
• Image 1: Human fetal heart, MCF7
  
  Host: Rabbit
  Target: SCN3B
  Positive control (+): Human fetal heart (HE)
  Negative control (-): MCF7 (N10)
  Antibody concentration: 1ug/ml
• Image 2: Human DLD1
  
  Host: Rabbit
  Target Name: SCN3B
  Sample Tissue: Human DLD1
  Antibody Dilution: 1.0ug/ml